PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01910.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 580aa    MW: 63306.4 Da    PI: 8.4249
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01910.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR505.8e-16301339240
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              ++k+CnCk+skClk+YCeCfaag++C   C+C dC+Nk 
  Rsa1.0_01910.1_g00001.1 301 SCKRCNCKRSKCLKLYCECFAAGVYCIGPCSCVDCFNKP 339
                              689**********************************96 PP

2TCR51.61.8e-16387426140
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN  
  Rsa1.0_01910.1_g00001.1 387 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNAF 426
                              589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.3E-18300341IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.598301427IPR005172CRC domain
PfamPF036389.9E-12303338IPR005172CRC domain
SMARTSM011149.9E-17387428IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.3E-12389425IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MDTPKKTATQ SENPVSKLKL ENSPVYNYIN SLSPIKPVRS LTFPQTIGSL SYSSPPSVFT  60
SPHASSHKGS RFKSDDTNSS KDVPASVGEE ALHETEPPQI QQNECTTIAT PPRVISDNET  120
DLLKMCDGNV KQKSEIPDWN AMILGYDDIL IDDPNNESEA SRCFLERSTE SKARLLSVTN  180
SDDALHRRVT KRCLDFEMPG NNKHMSVESS SRCVVANIGL HLSTIAVSSK DNSVGNDYSL  240
SGHSKVGLRG SISAVHNSQE TVKDNGQGLK EGAMSLALVE LNQSSPKKKR QVEQAGEAES  300
SCKRCNCKRS KCLKLYCECF AAGVYCIGPC SCVDCFNKPI HEDTVMSTRK QIESRNPLAF  360
APKVIGNSDS VVEIGDGNAS KTPASARHKR GCNCKKSNCL KKYCECYQSG VGCSINCRCE  420
GCKNAFGKKY GSSFTGVHIK QDKENETSER GRTEKQPSTP MPLRQPLAHL PISSNNILLP  480
HQHLHGASGS SLLKSQSFKR QDMSLLSHSN IETITEKKAD DIENLIQSPI TNMINNAVTP  540
NSKRVSPPHV GSSELSPCRR NGGRKLLLSV PTFPSLSPHH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584927.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
RefseqXP_013695714.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A078FF020.0A0A078FF02_BRANA; BnaA05g16940D protein
STRINGBra033920.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein